ITGA3 antibody (Cytoplasmic Domain)
-
- Target See all ITGA3 Antibodies
- ITGA3 (Integrin, alpha 3 (ITGA3))
-
Binding Specificity
- Cytoplasmic Domain
-
Reactivity
- Human
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This ITGA3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Specificity
- Recognizes specifically the cytoplasmic domain of integrin subunit alpha-3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.
- Purification
- Purified
- Immunogen
-
Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin
Type of Immunogen: Synthetic peptide - Clone
- 29A3
- Isotype
- IgG1
- Top Product
- Discover our top product ITGA3 Primary Antibody
-
-
- Application Notes
-
Approved: ICC, IHC, IHC-Fr (1:100 - 1:200), WB (1:100 - 1:1000)
Not recommended for: IHC-P - Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- PBS containing 0.09 % sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- avoid freeze thaw cycles. Store undiluted.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles. Store undiluted.
-
- Target
- ITGA3 (Integrin, alpha 3 (ITGA3))
- Alternative Name
- ITGA3 / CD49c (ITGA3 Products)
- Synonyms
- CD49C antibody, GAP-B3 antibody, GAPB3 antibody, ILNEB antibody, MSK18 antibody, VCA-2 antibody, VL3A antibody, VLA3a antibody, ITGA3 antibody, AA407068 antibody, integrin subunit alpha 3 antibody, integrin subunit alpha 3 S homeolog antibody, integrin alpha 3 antibody, ITGA3 antibody, itga3.S antibody, Itga3 antibody
- Background
-
Name/Gene ID: ITGA3
Family: Integrin
Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18 - Gene ID
- 3675
- UniProt
- P26006
- Pathways
- CXCR4-mediated Signaling Events, Integrin Complex
-