ITGA3 antibody (Cytoplasmic Domain)

Catalog No. ABIN959436

Product Details anti-ITGA3 Antibody

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Binding Specificity: Cytoplasmic Domain

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This ITGA3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunocytochemistry (ICC)

Specificity: Recognizes specifically the cytoplasmic domain of integrin subunit alpha-3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.

Purification: Purified

Immunogen: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin

Type of Immunogen: Synthetic peptide

Clone: 29A3

Isotype: IgG1

Application Details

Application Notes: Approved: ICC, IHC, IHC-Fr (1:100 - 1:200), WB (1:100 - 1:1000)

Not recommended for: IHC-P

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: PBS containing 0.09 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles. Store undiluted.

Storage: 4 °C,-20 °C

Storage Comment: Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles. Store undiluted.

Target Details for ITGA3

Target: ITGA3 (Integrin, alpha 3 (ITGA3))

Alternative Name: ITGA3 / CD49c (ITGA3 Products)

Background: Name/Gene ID: ITGA3
Family: Integrin

Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18

Gene ID: 3675

UniProt: P26006

Pathways: CXCR4-mediated Signaling Events, Integrin Complex