ITGA3 antibody (Cytoplasmic Domain)
-
- Target See all ITGA3 Antibodies
- ITGA3 (Integrin, alpha 3 (ITGA3))
-
Binding Specificity
- Cytoplasmic Domain
-
Reactivity
- Human
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This ITGA3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Specificity
- Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit alpha-3A. A broad species reactivity is expected because of the conserved nature of the epitope.
- Purification
- Purified
- Immunogen
- Peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin
- Clone
- 158A3
- Isotype
- IgG2a
- Top Product
- Discover our top product ITGA3 Primary Antibody
-
anti-Integrin, alpha 3 (ITGA3) (AA 33-236) antibody
ITGA3 Reactivity: Mouse WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 63-248) antibodyITGA3 Reactivity: Human WB, ELISA, IHC, FACS, ICC, Neut Host: Mouse Monoclonal 3F6D6 unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 976-1025) antibodyITGA3 Reactivity: Mouse, Pig WB, ELISA, FACS, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) antibodyITGA3 Reactivity: Human, Mouse WB, ELISA, ICC, IF Host: Rabbit Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 168-276) antibodyITGA3 Reactivity: Human ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) antibodyITGA3 Reactivity: Human, Mouse, Rat WB, ELISA, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (Internal Region) antibodyITGA3 Reactivity: Human, Mouse, Rat WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 165-199), (N-Term) antibodyITGA3 Reactivity: Human WB Host: Rabbit Polyclonal RB52792 unconjugated
anti-Integrin, alpha 3 (ITGA3) antibodyITGA3 Reactivity: Human, Mouse ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (Internal Region) antibodyITGA3 Reactivity: Human, Monkey IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
Approved: ICC, IHC, IHC-Fr (1:100 - 1:200), WB (1:100 - 1:1000)
Not recommended for: IHC-P - Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- PBS containing 0.09 % sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- avoid freeze thaw cycles. Store undiluted.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles. Store undiluted.
-
- Target
- ITGA3 (Integrin, alpha 3 (ITGA3))
- Alternative Name
- ITGA3 / CD49c (ITGA3 Products)
- Synonyms
- CD49C antibody, GAP-B3 antibody, GAPB3 antibody, ILNEB antibody, MSK18 antibody, VCA-2 antibody, VL3A antibody, VLA3a antibody, ITGA3 antibody, AA407068 antibody, integrin subunit alpha 3 antibody, integrin subunit alpha 3 S homeolog antibody, integrin alpha 3 antibody, ITGA3 antibody, itga3.S antibody, Itga3 antibody
- Background
-
Name/Gene ID: ITGA3
Family: Integrin
Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18 - Gene ID
- 3675
- UniProt
- P26006
- Pathways
- CXCR4-mediated Signaling Events, Integrin Complex
-
