PPP1R8 antibody
-
- Target See all PPP1R8 Antibodies
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
-
Reactivity
- Archaeoprepona
-
Host
- Goat
-
Clonality
- Polyclonal
-
Conjugate
- This PPP1R8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Cross-Reactivity (Details)
- Archeoprepona genus
- Purification
- Epitope affinity purified
- Immunogen
- Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli
- Isotype
- IgG
- Top Product
- Discover our top product PPP1R8 Primary Antibody
-
-
- Application Notes
- WB:1:500-1:2,000
- Comment
-
Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin
- Restrictions
- For Research Use only
-
- Concentration
- 2 mg/mL
- Buffer
- PBS, 20 % glycerol and 0.05 % sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at -20 °C for long-term storage. Store at 2-8 °C for up to one month.
-
- Target
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
- Alternative Name
- ARD1 (PPP1R8 Products)
- Synonyms
- ARD-1 antibody, ARD1 antibody, NIPP-1 antibody, NIPP1 antibody, PRO2047 antibody, 6330548N22Rik antibody, AU044684 antibody, PPP1R8 antibody, ard-1 antibody, ard1 antibody, nipp-1 antibody, nipp1 antibody, ppp1r8 antibody, si:ch211-206a7.1 antibody, protein phosphatase 1 regulatory subunit 8 antibody, protein phosphatase 1, regulatory subunit 8 antibody, protein phosphatase 1, regulatory (inhibitor) subunit 8 antibody, protein phosphatase 1, regulatory subunit 8b antibody, protein phosphatase 1 regulatory subunit 8 L homeolog antibody, protein phosphatase 1, regulatory subunit 8a antibody, protein phosphatase 1 regulatory subunit 8 S homeolog antibody, PPP1R8 antibody, Ppp1r8 antibody, ppp1r8b antibody, ppp1r8.L antibody, ppp1r8a antibody, ppp1r8.S antibody
-