-
- Target See all PPP1R8 Antibodies
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
-
Reactivity
- Archaeoprepona
-
Host
- Goat
-
Clonality
- Polyclonal
-
Conjugate
- This PPP1R8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Cross-Reactivity (Details)
- Archeoprepona genus
- Purification
- Epitope affinity purified
- Immunogen
- Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli
- Isotype
- IgG
- Top Product
- Discover our top product PPP1R8 Primary Antibody
-
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 1-209) antibody
PPP1R8 Reactivity: Human WB, ELISA, IF Host: Mouse Monoclonal 1G11 unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 1-209) antibodyPPP1R8 Reactivity: Human WB, ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 28-127) antibodyPPP1R8 Reactivity: Human WB, ELISA, IP Host: Mouse Monoclonal 4B5 unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (C-Term) antibodyVerified PPP1R8 Reactivity: Human, Mouse WB, ELISA, IHC Host: Goat Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 21-120) antibodyPPP1R8 Reactivity: Mouse, Zebrafish (Danio rerio) WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 71-120) antibodyPPP1R8 Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Guinea Pig, Monkey, Pig, Bat, Hamster, Xenopus laevis, Chicken WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) antibodyPPP1R8 Reactivity: Human, Mouse, Rat, Dog WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (N-Term) antibodyPPP1R8 Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Cow, Dog, Horse, Rabbit, Guinea Pig WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (Internal Region) antibodyPPP1R8 Reactivity: Human, Mouse, Rat WB, ELISA, IHC, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 91-140) antibodyPPP1R8 Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Guinea Pig, Monkey, Pig, Bat, Hamster, Xenopus laevis WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- WB:1:500-1:2,000
- Comment
-
Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin
- Restrictions
- For Research Use only
-
- Concentration
- 2 mg/mL
- Buffer
- PBS, 20 % glycerol and 0.05 % sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at -20 °C for long-term storage. Store at 2-8 °C for up to one month.
-
- Target
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
- Alternative Name
- ARD1 (PPP1R8 Products)
-
You are here:
