Peptide YY antibody

Catalog No. ABIN7211624

Product Details anti-Peptide YY Antibody

Target: Peptide YY (PYY)

Reactivity: Various Species

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peptide YY antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificity: Recognizes PYY in a wide range of species.

Characteristics: Peptide YY| PYY,Peptide tyrosine tyrosine polyclonal antibody

Purification: Whole rabbit serum.

Immunogen: Natural pig PYY (peptide with tyrosine, HYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2.).

Application Details

Application Notes: Western Blot (1:1,000, ECL)Suggested dilutions/conditions may not be available for all applications.Optimal conditions must be determined individually for each application.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Liquid. Antiserum containing 10 mM sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid freeze/thaw cycles.

Storage: -20 °C

Target Details for Peptide YY

Target: Peptide YY (PYY)

Alternative Name: Peptide tyrosine tyrosine (PYY Products)

Synonyms: PYY-I antibody, PYY1 antibody, GHYY antibody, RATGHYY antibody, Yy antibody, peptide-YY antibody, peptide YY antibody, peptide YY (mapped) antibody, PYY antibody, Pyy antibody

UniProt: P68005