ENO2/NSE antibody (AA 2-285)
-
- Target See all ENO2/NSE (ENO2) Antibodies
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
-
Binding Specificity
- AA 2-285
-
Reactivity
- Human
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This ENO2/NSE antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Purpose
- Monoclonal Antibody to Enolase, Neuron Specific (NSE)
- Specificity
- The antibody is a mouse monoclonal antibody raised against NSE. It has been selected for its ability to recognize NSE in immunohistochemical staining and western blotting.
- Cross-Reactivity
- Mouse, Rat
- Purification
- Protein A + Protein G affinity chromatography
- Immunogen
- Recombinant Enolase, Neuron Specific (NSE) corresdonding to Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT with N-terminal His Tag
- Clone
- C3
- Isotype
- IgG2b kappa
- Top Product
- Discover our top product ENO2 Primary Antibody
-
-
- Application Notes
-
Western blotting: 0.5-2 μg/mL
1:500-2000 Immunohistochemistry: 5-20 μg/mL
1:50-200 Immunocytochemistry: 5-20 μg/mL
1:50-200 Optimal working dilutions must be determined by end user.
- Comment
-
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
- Expiry Date
- 24 months
-
- Target
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
- Alternative Name
- Enolase, Neuron Specific (ENO2 Products)
- Synonyms
- ENO2 antibody, DKFZp459B1817 antibody, NSE antibody, AI837106 antibody, D6Ertd375e antibody, Eno-2 antibody, RNEN3 antibody, eno3 antibody, wu:fc09h05 antibody, zgc:92418 antibody, enolase 2 antibody, enolase 2 (gamma, neuronal) antibody, enolase 2, gamma neuronal antibody, enolase 2, gamma, neuronal antibody, ENO2 antibody, Eno2 antibody, eno2 antibody
- Background
- ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase
-