DEFB4A antibody (AA 4-41)

Catalog No. ABIN6757739

Product Details anti-DEFB4A Antibody

Target: DEFB4A (DEFB4) (Defensin, beta 4A (DEFB4))

Binding Specificity: AA 4-41

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This DEFB4A antibody is un-conjugated

Application: ELISA

Specificity: Recognizes human beta-Defensin 2 (epitope: aa 4-41).

Predicted Reactivity: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%) Gibbon, Monkey (97%) Orangutan (81%).

Purification: Protein G purified

Immunogen: Synthetic human -Defensin 2 (aa 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%), Gibbon, Monkey (97%), Orangutan (81%).

Clone: L12-4C-C2

Isotype: IgG1

Application Details

Application Notes: Approved: ELISA

Usage: Suitable for use in ELISA.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Sterile buffer or distilled water

Concentration: Lot specific

Buffer: Lyophilized from 50 mM Tris,  pH 7.4

Storage: -20 °C

Storage Comment: Lyophilized powder may be stored at -20°C. Aliquot and store at -20°C. Reconstituted product is stable for 1 year at -20°C.

Target Details for DEFB4A

Target: DEFB4A (DEFB4) (Defensin, beta 4A (DEFB4))

Alternative Name: DEFB4A / DEFB2 (DEFB4 Products)

Background: Name/Gene ID: DEFB4A

Synonyms: DEFB4A, Beta-defensin 2, Beta-defensin 4A, DEFB-2, DEFB102, Defensin, beta 2, Defensin, beta 4, Defensin, beta 4A, DEFB4, DEFB2, HBD-2, Skin-antimicrobial peptide 1, BD-2, SAP1

Gene ID: 1673