SCN4B antibody
-
- Target See all SCN4B Antibodies
- SCN4B (Sodium Channel, Voltage-Gated, Type IV, beta Subunit (SCN4B))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SCN4B antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for SCN4B detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- LRDLEFSDTG KYTCHVKNPK ENNLQHHATI FLQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for SCN4B detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human SCN4B (LRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ).
- Isotype
- IgG
- Top Product
- Discover our top product SCN4B Primary Antibody
-
-
- Application Notes
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL
- Comment
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SCN4B (Sodium Channel, Voltage-Gated, Type IV, beta Subunit (SCN4B))
- Alternative Name
- SCN4B (SCN4B Products)
- Synonyms
- LQT10 antibody, Navbeta4 antibody, Gm1471 antibody, sb:cb973 antibody, scn4b.2 antibody, si:ch211-139a5.5 antibody, scn4b.1 antibody, scn4b1 antibody, zgc:165389 antibody, sodium voltage-gated channel beta subunit 4 antibody, sodium channel, type IV, beta antibody, sodium channel, voltage-gated, type IV, beta b antibody, sodium channel, voltage-gated, type IV, beta a antibody, SCN4B antibody, Scn4b antibody, scn4bb antibody, scn4ba antibody
- Background
-
Synonyms: Sodium channel subunit beta-4, SCN4B
Background: Sodium channel β-subunit 4, also known as SCN4B or Naβ4, is a protein that in humans is encoded by the SCN4B gene. The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.
- Gene ID
- 6330
-