TMEM166 antibody
-
- Target See all TMEM166 (FAM176A) Antibodies
- TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM166 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS), Immunocytochemistry (ICC)
- Purpose
- Rabbit IgG polyclonal antibody for TMEM166/EVA1A detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Sequence
- MRLPLSHSPE HVEMALLSNI LAAYSFVSEN PERA
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for TMEM166/EVA1A detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A(MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).
- Isotype
- IgG
- Top Product
- Discover our top product FAM176A Primary Antibody
-
-
- Application Notes
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells
- Comment
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))
- Alternative Name
- EVA1A (FAM176A Products)
- Synonyms
- Fam176a antibody, RGD1559797 antibody, Tmem166 antibody, FAM176A antibody, TMEM166 antibody, BC014699 antibody, eva-1 homolog A, regulator of programmed cell death antibody, eva-1 homolog A (C. elegans) antibody, Eva1a antibody, EVA1A antibody
- Background
-
Synonyms: Protein eva-1 homolog A, Protein FAM176A, Transmembrane protein 166, EVA1A, FAM176A, TMEM166, SP24
Background: Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
- Gene ID
- 84141
- UniProt
- Q9H8M9
-