SLC34A2 antibody
-
- Target See all SLC34A2 Antibodies
- SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))
- Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC34A2 antibody is un-conjugated
- Application
- Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for SLC34A2 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Sequence
- QNWTMKNVTY KENIAKCQHI FVNFHLPDLA
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for SLC34A2 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).
- Isotype
- IgG
- Top Product
- Discover our top product SLC34A2 Primary Antibody
-
-
- Application Notes
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells
- Comment
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))
- Alternative Name
- SLC34A2 (SLC34A2 Products)
- Background
-
Synonyms: Sodium-dependent phosphate transport protein 2B, Sodium-phosphate transport protein 2B, Na(+)-dependent phosphate cotransporter 2B, NaPi3b, Sodium/phosphate cotransporter 2B, Na(+)/Pi cotransporter 2B, NaPi-2b, Solute carrier family 34 member 2, SLC34A2
Background: Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH -sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH . Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.
- Gene ID
- 10568
- UniProt
- O95436
-