PCDH15 antibody

Catalog No. ABIN6719362

Product Details anti-PCDH15 Antibody

Target: PCDH15 (Protocadherin-15 (PCDH15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDH15 antibody is un-conjugated

Application: Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS), Immunohistochemistry (Frozen Sections) (IHC (fro))

Purpose: Rabbit IgG polyclonal antibody for PCDH15 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Sequence: DLTVYAIDPQ TNRAIDRNEL FKFLDGKLLD INKDFQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for PCDH15 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human PCDH15(DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ).

Isotype: IgG

Application Details

Application Notes:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Comment:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PCDH15

Target: PCDH15 (Protocadherin-15 (PCDH15))

Alternative Name: PCDH15 (PCDH15 Products)

Synonyms: CDHR15 antibody, DFNB23 antibody, USH1F antibody, BB078305 antibody, ENSMUSG00000046980 antibody, Gm9815 antibody, Ush1f antibody, av antibody, nmf19 antibody, protocadherin-15 antibody, protocadherin related 15 antibody, protocadherin-15 antibody, protocadherin 15 antibody, PCDH15 antibody, CpipJ_CPIJ005081 antibody, Pcdh15 antibody

Background:

Synonyms: Protocadherin-15, PCDH15, USH1F

Background: Protocadherin-15 is a protein that in humans is encoded by the PCDH15 gene. This gene is mapped to 10q21.1. This gene is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). Extensive alternative splicing resulting in multiple isoforms has been observed in the mouse ortholog. Similar alternatively spliced transcripts are inferred to occur in human, and additional variants are likely to occur.

Gene ID: 65217

Pathways: Sensory Perception of Sound