Sucrase Isomaltase antibody

Catalog No. ABIN6654192

Product Details anti-Sucrase Isomaltase Antibody

Target: Sucrase Isomaltase (SI) (Sucrase-Isomaltase (Alpha-Glucosidase) (SI))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Sucrase Isomaltase antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID were used as the immunogen for the Sucrase Isomaltase antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Sucrase Isomaltase antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Sucrase Isomaltase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Sucrase Isomaltase

Target: Sucrase Isomaltase (SI) (Sucrase-Isomaltase (Alpha-Glucosidase) (SI))

Alternative Name: SI / Sucrase Isomaltase (SI Products)

Synonyms: 2010204N08Rik antibody, SI antibody, Si-s antibody, SUCIMAL antibody, sucrase-isomaltase, intestinal antibody, sucrase isomaltase (alpha-glucosidase) antibody, sucrase-isomaltase antibody, Tsp_13316 antibody, Tsp_01057 antibody, Sis antibody, SI antibody, Si antibody

Background: This gene is mapped to 3q26.1. It encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.

UniProt: P14410