ZPLD1 antibody (C-Term)

Catalog No. ABIN636115

Product Details anti-ZPLD1 Antibody

Target: ZPLD1 (Zona Pellucida-Like Domain Containing 1 (ZPLD1))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZPLD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZPLD1 antibody was raised against the C terminal of ZPLD1

Purification: Affinity purified

Immunogen: ZPLD1 antibody was raised using the C terminal of ZPLD1 corresponding to a region with amino acids DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZPLD1 Blocking Peptide, catalog no. 33R-1851, is also available for use as a blocking control in assays to test for specificity of this ZPLD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZPLD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZPLD1

Target: ZPLD1 (Zona Pellucida-Like Domain Containing 1 (ZPLD1))

Alternative Name: ZPLD1 (ZPLD1 Products)

Synonyms: 9430016A21Rik antibody, zona pellucida like domain containing 1 antibody, si:ch211-229d2.5 antibody, zona pellucida-like domain containing 1 S homeolog antibody, ZPLD1 antibody, si:ch211-229d2.5 antibody, zpld1 antibody, Zpld1 antibody, zpld1.S antibody

Background: The function of ZPLD1 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 47 kDa (MW of target protein)