SLC19A3 antibody (Middle Region)
-
- Target See all SLC19A3 (Slc19a3) Antibodies
- SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC19A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC19 A3 antibody was raised against the middle region of SLC19 3
- Purification
- Affinity purified
- Immunogen
- SLC19 A3 antibody was raised using the middle region of SLC19 3 corresponding to a region with amino acids FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY
- Top Product
- Discover our top product Slc19a3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC19A3 Blocking Peptide, catalog no. 33R-2848, is also available for use as a blocking control in assays to test for specificity of this SLC19A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))
- Alternative Name
- SLC19A3 (Slc19a3 Products)
- Synonyms
- BBGD antibody, THMD2 antibody, THTR2 antibody, thtr2 antibody, MGC52872 antibody, MGC89434 antibody, si:dkey-223n17.4 antibody, slc19a3 antibody, A230084E24Rik antibody, AI788884 antibody, ThTr2 antibody, solute carrier family 19 member 3 antibody, solute carrier family 19 member 3 L homeolog antibody, solute carrier family 19 (thiamine transporter), member 3 antibody, thiamine transporter 2 antibody, solute carrier family 19 (thiamine transporter), member 3b antibody, solute carrier family 19, member 3 antibody, thiamine transporter 2-like antibody, SLC19A3 antibody, Slc19a3 antibody, slc19a3.L antibody, slc19a3 antibody, LOC486151 antibody, slc19a3b antibody, LOC100230080 antibody
- Background
- SLC19A3 mediates high affinity thiamine uptake, propably via a proton anti-port mechanism. SLC19A3 has no folate transport activity.SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-