SLC20A2 antibody

Catalog No. ABIN636107

Product Details anti-SLC20A2 Antibody

Target: SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC20A2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC20 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC20A2 Blocking Peptide, catalog no. 33R-2221, is also available for use as a blocking control in assays to test for specificity of this SLC20A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC20A2

Target: SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))

Alternative Name: SLC20A2 (SLC20A2 Products)

Synonyms: wu:fi23g11 antibody, zgc:152990 antibody, glvr-2 antibody, glvr2 antibody, mlvar antibody, pit-2 antibody, pit2 antibody, SLC20A2 antibody, GLVR-2 antibody, GLVR2 antibody, IBGC3 antibody, MLVAR antibody, PIT-2 antibody, PIT2 antibody, RAM1 antibody, Ab1-188 antibody, Glvr2 antibody, Pit-2 antibody, RAM-1 antibody, Ram1 antibody, MolPit2 antibody, Pit2 antibody, Ram-1 antibody, ChoPit2 antibody, HaPit2 antibody, PiT-2 antibody, solute carrier family 20 member 2 antibody, solute carrier family 20 (phosphate transporter), member 2 antibody, solute carrier family 20 (phosphate transporter), member 2 L homeolog antibody, solute carrier family 20, member 2 antibody, SLC20A2 antibody, slc20a2 antibody, slc20a2.L antibody, Slc20a2 antibody

Background: SLC20A2 is a sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. It may play a role in extracellular matrix, cartilage and vascular calcification.

Molecular Weight: 70 kDa (MW of target protein)