SLC20A2 antibody
-
- Target See all SLC20A2 Antibodies
- SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC20A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC20 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF
- Top Product
- Discover our top product SLC20A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC20A2 Blocking Peptide, catalog no. 33R-2221, is also available for use as a blocking control in assays to test for specificity of this SLC20A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))
- Alternative Name
- SLC20A2 (SLC20A2 Products)
- Background
- SLC20A2 is a sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. It may play a role in extracellular matrix, cartilage and vascular calcification.
- Molecular Weight
- 70 kDa (MW of target protein)
-