UGT2B15 antibody (N-Term)

Catalog No. ABIN636105

Product Details anti-UGT2B15 Antibody

Target: UGT2B15 (UDP Glucuronosyltransferase 2 Family, Polypeptide B15 (UGT2B15))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT2B15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGT2 B15 antibody was raised against the N terminal of µgT2 15

Purification: Affinity purified

Immunogen: UGT2 B15 antibody was raised using the N terminal of µgT2 15 corresponding to a region with amino acids IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT2B15 Blocking Peptide, catalog no. 33R-4025, is also available for use as a blocking control in assays to test for specificity of this µgT2B15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT2B15

Target: UGT2B15 (UDP Glucuronosyltransferase 2 Family, Polypeptide B15 (UGT2B15))

Alternative Name: UGT2B15 (UGT2B15 Products)

Synonyms: UGT2B28 antibody, HLUG4 antibody, UDPGT 2B8 antibody, UDPGT2B15 antibody, UDPGTH3 antibody, UGT2B8 antibody, UDP-glucuronosyltransferase 2B15 antibody, UDP glucuronosyltransferase family 2 member B15 antibody, LOC461289 antibody, LOC100591991 antibody, UGT2B15 antibody

Background: The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis