IZUMO1 antibody (C-Term)

Catalog No. ABIN636096

Product Details anti-IZUMO1 Antibody

Target: IZUMO1 (Izumo Sperm-Egg Fusion 1 (IZUMO1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IZUMO1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IZUMO1 antibody was raised against the C terminal of IZUMO1

Purification: Affinity purified

Immunogen: IZUMO1 antibody was raised using the C terminal of IZUMO1 corresponding to a region with amino acids SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IZUMO1 Blocking Peptide, catalog no. 33R-8575, is also available for use as a blocking control in assays to test for specificity of this IZUMO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IZUMO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IZUMO1

Target: IZUMO1 (Izumo Sperm-Egg Fusion 1 (IZUMO1))

Alternative Name: IZUMO1 (IZUMO1 Products)

Synonyms: IZUMO antibody, 1700058F15Rik antibody, Izumo antibody, izumo sperm-egg fusion 1 antibody, Ras interacting protein 1 antibody, IZUMO1 antibody, RASIP1 antibody, Izumo1 antibody

Background: The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion.

Molecular Weight: 39 kDa (MW of target protein)