LRRC33 antibody (N-Term)

Catalog No. ABIN636092

Product Details anti-LRRC33 Antibody

Target: LRRC33 (NRROS) (Negative Regulator of Reactive Oxygen Species (NRROS))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC33 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC33 antibody was raised against the N terminal of LRRC33

Purification: Affinity purified

Immunogen: LRRC33 antibody was raised using the N terminal of LRRC33 corresponding to a region with amino acids GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC33 Blocking Peptide, catalog no. 33R-3389, is also available for use as a blocking control in assays to test for specificity of this LRRC33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC33

Target: LRRC33 (NRROS) (Negative Regulator of Reactive Oxygen Species (NRROS))

Alternative Name: LRRC33 (NRROS Products)

Synonyms: GARPL1 antibody, LRRC33 antibody, UNQ3030 antibody, negative regulator of reactive oxygen species antibody, NRROS antibody

Background: The function of LRRC33 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 76 kDa (MW of target protein)