IL13RA2 antibody (Middle Region)
-
- Target See all IL13RA2 Antibodies
- IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IL13RA2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IL13 RA2 antibody was raised against the middle region of IL13 A2
- Purification
- Affinity purified
- Immunogen
- IL13 RA2 antibody was raised using the middle region of IL13 A2 corresponding to a region with amino acids GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
- Top Product
- Discover our top product IL13RA2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IL13RA2 Blocking Peptide, catalog no. 33R-3505, is also available for use as a blocking control in assays to test for specificity of this IL13RA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))
- Alternative Name
- IL13RA2 (IL13RA2 Products)
- Synonyms
- il-13ra2 antibody, sb:cb602 antibody, si:dkeyp-110c7.6 antibody, CD213A2 antibody, CT19 antibody, IL-13R antibody, IL13BP antibody, CD213a2 antibody, IL-13R-alpha-2 antibody, IL13RA2 antibody, interleukin 13 receptor, alpha 2 antibody, interleukin 13 receptor subunit alpha 2 antibody, interleukin 13 receptor subunit alpha 2 S homeolog antibody, il13ra2 antibody, IL13RA2 antibody, il13ra2.S antibody, Il13ra2 antibody
- Background
- IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.
- Molecular Weight
- 42 kDa (MW of target protein)
-