MAGT1 antibody (N-Term)

Catalog No. ABIN636081

Product Details anti-MAGT1 Antibody

Target: MAGT1 (Magnesium Transporter 1 (MAGT1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RP11-217 H1.1 antibody was raised against the N terminal Of Rp11-217 1.1

Purification: Affinity purified

Immunogen: RP11-217 H1.1 antibody was raised using the N terminal Of Rp11-217 1.1 corresponding to a region with amino acids ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RP11-217H1.1 Blocking Peptide, catalog no. 33R-1500, is also available for use as a blocking control in assays to test for specificity of this RP11-217H1.1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-210 1.1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGT1

Target: MAGT1 (Magnesium Transporter 1 (MAGT1))

Alternative Name: RP11-217H1.1 (MAGT1 Products)

Synonyms: IAP antibody, MRX95 antibody, OST3B antibody, PRO0756 antibody, XMEN antibody, bA217H1.1 antibody, 2410001C15Rik antibody, 2610529C04Rik antibody, 2810482I07Rik antibody, IAG2 antibody, Iag2 antibody, magnesium transporter 1 antibody, MAGT1 antibody, Magt1 antibody

Background: The function of RP11-217H1.1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis