MAGT1 antibody (N-Term)
-
- Target See all MAGT1 Antibodies
- MAGT1 (Magnesium Transporter 1 (MAGT1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAGT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RP11-217 H1.1 antibody was raised against the N terminal Of Rp11-217 1.1
- Purification
- Affinity purified
- Immunogen
- RP11-217 H1.1 antibody was raised using the N terminal Of Rp11-217 1.1 corresponding to a region with amino acids ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP
- Top Product
- Discover our top product MAGT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RP11-217H1.1 Blocking Peptide, catalog no. 33R-1500, is also available for use as a blocking control in assays to test for specificity of this RP11-217H1.1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-210 1.1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGT1 (Magnesium Transporter 1 (MAGT1))
- Alternative Name
- RP11-217H1.1 (MAGT1 Products)
- Synonyms
- IAP antibody, MRX95 antibody, OST3B antibody, PRO0756 antibody, XMEN antibody, bA217H1.1 antibody, 2410001C15Rik antibody, 2610529C04Rik antibody, 2810482I07Rik antibody, IAG2 antibody, Iag2 antibody, magnesium transporter 1 antibody, MAGT1 antibody, Magt1 antibody
- Background
- The function of RP11-217H1.1 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-