Parathyroid Hormone 2 (PTH2) (Middle Region) antibody
-
- Target See all Parathyroid Hormone 2 (PTH2) Antibodies
- Parathyroid Hormone 2 (PTH2)
-
Binding Specificity
- Middle Region
-
Reactivity
- Hormone
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PTH2 antibody was raised against the middle region of PTH2
- Purification
- Affinity purified
- Immunogen
- PTH2 antibody was raised using the middle region of PTH2 corresponding to a region with amino acids WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
- Top Product
- Discover our top product PTH2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTH2 Blocking Peptide, catalog no. 33R-9931, is also available for use as a blocking control in assays to test for specificity of this PTH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Parathyroid Hormone 2 (PTH2)
- Alternative Name
- PTH2 (PTH2 Products)
- Target Type
- Hormone
- Background
- TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.
- Molecular Weight
- 11 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development
-