CTRB1 antibody (Middle Region)

Catalog No. ABIN636071

Product Details anti-CTRB1 Antibody

Target: CTRB1 (Chymotrypsinogen B1 (CTRB1))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CTRB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Chymotrypsinogen B1 antibody was raised against the middle region of CTRB1

Purification: Affinity purified

Immunogen: Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Chymotrypsinogen B1 Blocking Peptide, catalog no. 33R-2951, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsinogen B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CTRB1

Target: CTRB1 (Chymotrypsinogen B1 (CTRB1))

Alternative Name: Chymotrypsinogen B1 (CTRB1 Products)

Synonyms: wu:fb61f07 antibody, wu:fb69e12 antibody, CTRB1 antibody, 2200008D09Rik antibody, AI504462 antibody, Ctrb antibody, Prt-2 antibody, CTRB antibody, ctrb antibody, ctrb2 antibody, chymotrypsinogen B1 antibody, chymotrypsinogen B antibody, chymostrypsinogen B1-like antibody, chymotrypsinogen B1 L homeolog antibody, CTRB1 antibody, ctrb1 antibody, LOC618826 antibody, LOC713851 antibody, LOC479649 antibody, Ctrb1 antibody, ctrb1.L antibody, LOC102150576 antibody

Background: Alpha-chymotrypsin (EC 3.4.21.1) is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin.

Molecular Weight: 28 kDa (MW of target protein)