EPHX4 antibody (N-Term)

Catalog No. ABIN636062

Product Details anti-EPHX4 Antibody

Target: EPHX4 (Epoxide Hydrolase 4 (EPHX4))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPHX4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ABHD7 antibody was raised against the N terminal of ABHD7

Purification: Affinity purified

Immunogen: ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABHD7 Blocking Peptide, catalog no. 33R-3705, is also available for use as a blocking control in assays to test for specificity of this ABHD7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPHX4

Target: EPHX4 (Epoxide Hydrolase 4 (EPHX4))

Alternative Name: ABHD7 (EPHX4 Products)

Synonyms: ABHD7 antibody, EPHXRP antibody, Abhd7 antibody, Ephxrp antibody, Gm1382 antibody, epoxide hydrolase 4 antibody, EPHX4 antibody, Ephx4 antibody

Background: The specific function of ABHD7 is not yet known.

Molecular Weight: 42 kDa (MW of target protein)