DAGLB antibody (Middle Region)

Catalog No. ABIN636059

Product Details anti-DAGLB Antibody

Target: DAGLB (Diacylglycerol Lipase, beta (DAGLB))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAGLB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DAGLB antibody was raised against the middle region of DAGLB

Purification: Affinity purified

Immunogen: DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAGLB Blocking Peptide, catalog no. 33R-8863, is also available for use as a blocking control in assays to test for specificity of this DAGLB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAGLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAGLB

Target: DAGLB (Diacylglycerol Lipase, beta (DAGLB))

Alternative Name: DAGLB (DAGLB Products)

Synonyms: DAGLBETA antibody, KCCR13L antibody, E330036I19Rik antibody, RGD1310193 antibody, sn1-specific diacylglycerol lipase beta antibody, diacylglycerol lipase, beta antibody, diacylglycerol lipase beta antibody, LOC472286 antibody, daglb antibody, DAGLB antibody, LOC100286527 antibody, LOC100444000 antibody, Daglb antibody

Background: DAGLB belongs to the AB hydrolase superfamily.It catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. This protein is required for axonal growth during development and for retrograde synaptic signaling at mature synapses.

Molecular Weight: 74 kDa (MW of target protein)