Coagulation Factor X antibody (C-Term)

Catalog No. ABIN636058

Product Details anti-Coagulation Factor X Antibody

Target: Coagulation Factor X (F10)

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Coagulation Factor X antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Factor X antibody was raised against the C terminal of F10

Purification: Affinity purified

Immunogen: Factor X antibody was raised using the C terminal of F10 corresponding to a region with amino acids STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Factor X Blocking Peptide, catalog no. 33R-8874, is also available for use as a blocking control in assays to test for specificity of this Factor X antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of F10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Coagulation Factor X

Target: Coagulation Factor X (F10)

Alternative Name: Factor X (F10 Products)

Synonyms: FX antibody, FXA antibody, Cf10 antibody, fX antibody, fi12c10 antibody, wu:fi12c10 antibody, F10 antibody, f10 antibody, coagulation factor X antibody, Coagulation factor X antibody, coagulation factor 10 L homeolog antibody, F10 antibody, f10 antibody, CpipJ_CPIJ012712 antibody, CpipJ_CPIJ014863 antibody, CpipJ_CPIJ016937 antibody, CpipJ_CPIJ017791 antibody, fa10 antibody, f10.L antibody

Background: F10 is the vitamin K-dependent coagulation factor X of the blood coagulation cascade. This factor undergoes multiple processing steps before its preproprotein is converted to a mature two-chain form by the excision of the tripeptide RKR. Two chains of the factor are held together by 1 or more disulfide bonds, the light chain contains 2 EGF-like domains, while the heavy chain contains the catalytic domain which is structurally homologous to those of the other hemostatic serine proteases. The mature factor is activated by the cleavage of the activation peptide by factor IXa (in the intrisic pathway), or by factor VIIa (in the extrinsic pathway). The activated factor then converts prothrombin to thrombin in the presence of factor Va, Ca+2, and phospholipid during blood clotting.

Molecular Weight: 29 kDa (MW of target protein)