Layilin antibody (N-Term)
-
- Target See all Layilin (LAYN) Antibodies
- Layilin (LAYN)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Layilin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LAYN antibody was raised against the N terminal of LAYN
- Purification
- Affinity purified
- Immunogen
- LAYN antibody was raised using the N terminal of LAYN corresponding to a region with amino acids CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL
- Top Product
- Discover our top product LAYN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LAYN Blocking Peptide, catalog no. 33R-1833, is also available for use as a blocking control in assays to test for specificity of this LAYN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAYN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Layilin (LAYN)
- Alternative Name
- LAYN (LAYN Products)
- Synonyms
- LAYN antibody, si:dkey-27p23.2 antibody, E030012M19Rik antibody, Gm511 antibody, RGD1564444 antibody, layilin antibody, layilin a antibody, LAYN antibody, layna antibody, Layn antibody
- Background
- LAYN contains 1 C-type lectin domain. It is the receptor for hyaluronate.
- Molecular Weight
- 42 kDa (MW of target protein)
-