IMPG2 antibody (C-Term)
-
- Target See all IMPG2 Antibodies
- IMPG2 (Interphotoreceptor Matrix Proteoglycan 2 (IMPG2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IMPG2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IMPG2 antibody was raised against the C terminal of IMPG2
- Purification
- Affinity purified
- Immunogen
- IMPG2 antibody was raised using the C terminal of IMPG2 corresponding to a region with amino acids VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL
- Top Product
- Discover our top product IMPG2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IMPG2 Blocking Peptide, catalog no. 33R-9875, is also available for use as a blocking control in assays to test for specificity of this IMPG2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IMPG2 (Interphotoreceptor Matrix Proteoglycan 2 (IMPG2))
- Alternative Name
- IMPG2 (IMPG2 Products)
- Synonyms
- IPM200 antibody, RP56 antibody, SPACRCAN antibody, PG10.2 antibody, Rsbp antibody, Spacrcan antibody, Pg10.2 antibody, interphotoreceptor matrix proteoglycan 2 antibody, IMPG2 antibody, Impg2 antibody
- Background
- Interphotoreceptor matrix proteoglycan-2 (IMPG2) is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in th e fundus of the eye.
- Molecular Weight
- 138 kDa (MW of target protein)
-