IMPG2 antibody (C-Term)

Catalog No. ABIN636052

Product Details anti-IMPG2 Antibody

Target: IMPG2 (Interphotoreceptor Matrix Proteoglycan 2 (IMPG2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IMPG2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IMPG2 antibody was raised against the C terminal of IMPG2

Purification: Affinity purified

Immunogen: IMPG2 antibody was raised using the C terminal of IMPG2 corresponding to a region with amino acids VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IMPG2 Blocking Peptide, catalog no. 33R-9875, is also available for use as a blocking control in assays to test for specificity of this IMPG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IMPG2

Target: IMPG2 (Interphotoreceptor Matrix Proteoglycan 2 (IMPG2))

Alternative Name: IMPG2 (IMPG2 Products)

Synonyms: IPM200 antibody, RP56 antibody, SPACRCAN antibody, PG10.2 antibody, Rsbp antibody, Spacrcan antibody, Pg10.2 antibody, interphotoreceptor matrix proteoglycan 2 antibody, IMPG2 antibody, Impg2 antibody

Background: Interphotoreceptor matrix proteoglycan-2 (IMPG2) is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in th e fundus of the eye.

Molecular Weight: 138 kDa (MW of target protein)