GDE1 antibody (N-Term)
-
- Target See all GDE1 Antibodies
- GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GDE1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- GDE1 antibody was raised against the N terminal Of Gde1
- Purification
- Affinity purified
- Immunogen
- GDE1 antibody was raised using the N terminal Of Gde1 corresponding to a region with amino acids LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN
- Top Product
- Discover our top product GDE1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GDE1 Blocking Peptide, catalog no. 33R-5401, is also available for use as a blocking control in assays to test for specificity of this GDE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))
- Alternative Name
- GDE1 (GDE1 Products)
- Background
- GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.
- Molecular Weight
- 38 kDa (MW of target protein)
-