GALNT6 antibody

Catalog No. ABIN636038

Product Details anti-GALNT6 Antibody

Target: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALNT6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GALNT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALNT6 Blocking Peptide, catalog no. 33R-2472, is also available for use as a blocking control in assays to test for specificity of this GALNT6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALNT6

Target: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))

Alternative Name: GALNT6 (GALNT6 Products)

Synonyms: 4632410F13 antibody, AW047994 antibody, GalNAc-T6 antibody, fc23d02 antibody, fc56f12 antibody, wu:fc23d02 antibody, wu:fc56f12 antibody, zgc:77836 antibody, GALNAC-T6 antibody, GalNAcT6 antibody, galnac-t6 antibody, galnact6 antibody, polypeptide N-acetylgalactosaminyltransferase 6 antibody, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6) antibody, GALNT6 antibody, Galnt6 antibody, galnt6 antibody

Background: GALNT6 is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain.

Molecular Weight: 71 kDa (MW of target protein)