GPR56 antibody (N-Term)

Catalog No. ABIN636036

Product Details anti-GPR56 Antibody

Target: GPR56 (G Protein-Coupled Receptor 56 (GPR56))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPR56 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GPR56 antibody was raised against the N terminal of GPR56

Purification: Affinity purified

Immunogen: GPR56 antibody was raised using the N terminal of GPR56 corresponding to a region with amino acids MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPR56 Blocking Peptide, catalog no. 33R-5594, is also available for use as a blocking control in assays to test for specificity of this GPR56 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR56 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPR56

Target: GPR56 (G Protein-Coupled Receptor 56 (GPR56))

Alternative Name: GPR56 (GPR56 Products)

Synonyms: fc49b10 antibody, wu:fc49b10 antibody, BFPP antibody, TM7LN4 antibody, TM7XN1 antibody, Cyt28 antibody, GPR56 antibody, adhesion G protein-coupled receptor G1 antibody, G protein-coupled receptor 56 antibody, ADGRG1 antibody, adgrg1 antibody, Adgrg1 antibody, GPR56 antibody

Background: GPR56 could be involved in cell-cell interactions.

Molecular Weight: 76 kDa (MW of target protein)