HS6ST3 antibody (C-Term)
-
- Target See all HS6ST3 Antibodies
- HS6ST3 (Heparan Sulfate 6-O-Sulfotransferase 3 (HS6ST3))
-
Binding Specificity
- C-Term
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HS6ST3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HS6 ST3 antibody was raised against the C terminal of HS6 T3
- Purification
- Affinity purified
- Immunogen
- HS6 ST3 antibody was raised using the C terminal of HS6 T3 corresponding to a region with amino acids TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW
- Top Product
- Discover our top product HS6ST3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HS6ST3 Blocking Peptide, catalog no. 33R-9146, is also available for use as a blocking control in assays to test for specificity of this HS6ST3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HS6ST3 (Heparan Sulfate 6-O-Sulfotransferase 3 (HS6ST3))
- Alternative Name
- HS6ST3 (HS6ST3 Products)
- Synonyms
- HS6ST-3 antibody, 6OST3 antibody, RGD1560050 antibody, hs6st3 antibody, heparan sulfate 6-O-sulfotransferase 3 antibody, heparan sulfate 6-O-sulfotransferase 3b antibody, HS6ST3 antibody, Hs6st3 antibody, hs6st3b antibody
- Background
- Heparan sulfate (HS) sulfotransferases, such as HS6ST3, modify HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in proliferation and differentiation, adhesion, migration, inflammation, blood coagulation, and other diverse processes.
- Molecular Weight
- 55 kDa (MW of target protein)
-