B3GNT7 antibody (N-Term)
-
- Target See all B3GNT7 Antibodies
- B3GNT7 (beta-1,3-N-Acetylglucosaminyltransferase 7 (B3GNT7))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This B3GNT7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- B3 GNT7 antibody was raised against the N terminal of B3 NT7
- Purification
- Affinity purified
- Immunogen
- B3 GNT7 antibody was raised using the N terminal of B3 NT7 corresponding to a region with amino acids QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR
- Top Product
- Discover our top product B3GNT7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
B3GNT7 Blocking Peptide, catalog no. 33R-7546, is also available for use as a blocking control in assays to test for specificity of this B3GNT7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 NT7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GNT7 (beta-1,3-N-Acetylglucosaminyltransferase 7 (B3GNT7))
- Alternative Name
- B3GNT7 (B3GNT7 Products)
- Synonyms
- cb543 antibody, ssp1 antibody, beta3GnT7 antibody, C330001H22Rik antibody, beta-3GnT7 antibody, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 antibody, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 S homeolog antibody, b3gnt7 antibody, b3gnt7.S antibody, B3GNT7 antibody, B3gnt7 antibody
- Background
- B3GNT7 belongs to the glycosyltransferase 31 family. It may be involved in keratane sulfate biosynthesis. B3GNT7 transfers N-acetylgalactosamine on to keratan sulfate-related glycans. It may play a role in preventing cells from migrating out of the original tissues and invading surrounding tissues.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-