LAMP3 antibody (N-Term)

Catalog No. ABIN636028

Product Details anti-LAMP3 Antibody

Target: LAMP3 (Lysosomal-Associated Membrane Protein 3 (LAMP3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LAMP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LAMP3 antibody was raised against the N terminal of LAMP3

Purification: Affinity purified

Immunogen: LAMP3 antibody was raised using the N terminal of LAMP3 corresponding to a region with amino acids YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LAMP3 Blocking Peptide, catalog no. 33R-10246, is also available for use as a blocking control in assays to test for specificity of this LAMP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LAMP3

Target: LAMP3 (Lysosomal-Associated Membrane Protein 3 (LAMP3))

Alternative Name: LAMP3 (LAMP3 Products)

Synonyms: DC-LAMP antibody, CD208 antibody, DC LAMP antibody, DCLAMP antibody, LAMP antibody, LAMP-3 antibody, TSC403 antibody, 1200002D17Rik antibody, Cd208 antibody, lysosomal associated membrane protein 3 antibody, lysosomal-associated membrane protein 3 antibody, LAMP3 antibody, Lamp3 antibody

Background: LAMP3 might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer.

Molecular Weight: 44 kDa (MW of target protein)