HS3ST5 antibody

Catalog No. ABIN636027

Product Details anti-HS3ST5 Antibody

Target: HS3ST5 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 5 (HS3ST5))

Reactivity: Mouse, Rat, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HS3ST5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HS3 ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HS3ST5 Blocking Peptide, catalog no. 33R-8735, is also available for use as a blocking control in assays to test for specificity of this HS3ST5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HS3ST5

Target: HS3ST5 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 5 (HS3ST5))

Alternative Name: HS3ST5 (HS3ST5 Products)

Synonyms: 3-OST-5 antibody, 3OST5 antibody, HS3OST5 antibody, NBLA04021 antibody, D930005L05Rik antibody, Gm1151 antibody, Hs3ost5 antibody, HS3ST6 antibody, HS3ST5 antibody, heparan sulfate-glucosamine 3-sulfotransferase 5 antibody, heparan sulfate (glucosamine) 3-O-sulfotransferase 5 antibody, HS3ST5 antibody, Hs3st5 antibody, hs3st5 antibody

Background: HS3ST5 is the rate limiting enzyme for synthesis of HSact. It performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site. HS3ST5 also generates GlcUA-GlcNS or IdoUA-GlcNS and IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process