GALNT13 antibody (N-Term)

Catalog No. ABIN636022

Product Details anti-GALNT13 Antibody

Target: GALNT13 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALNT13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GALNT13 antibody was raised against the N terminal Of Galnt13

Purification: Affinity purified

Immunogen: GALNT13 antibody was raised using the N terminal Of Galnt13 corresponding to a region with amino acids CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALNT13 Blocking Peptide, catalog no. 33R-1754, is also available for use as a blocking control in assays to test for specificity of this GALNT13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALNT13

Target: GALNT13 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13))

Alternative Name: GALNT13 (GALNT13 Products)

Synonyms: si:ch1073-215b15.1 antibody, A230002A12 antibody, A230020F20 antibody, BB182356 antibody, GalNAc-T13 antibody, H_NH0187G20.1 antibody, WUGSC:H_NH0187G20.1 antibody, T13 antibody, polypeptide N-acetylgalactosaminyltransferase 13 antibody, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 antibody, polypeptide N-acetylgalactosaminyltransferase 13 S homeolog antibody, GALNT13 antibody, galnt13 antibody, LOC100544871 antibody, Galnt13 antibody, galnt13.S antibody

Background: The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase family, which initiate O-linked glycosylation of mucins by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.

Molecular Weight: 64 kDa (MW of target protein)