GLT8D2 antibody (C-Term)

Catalog No. ABIN636017

Product Details anti-GLT8D2 Antibody

Target: GLT8D2 (Glycosyltransferase 8 Domain Containing 2 (GLT8D2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLT8D2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLT8 D2 antibody was raised against the C terminal of GLT8 2

Purification: Affinity purified

Immunogen: GLT8 D2 antibody was raised using the C terminal of GLT8 2 corresponding to a region with amino acids IRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLT8D2 Blocking Peptide, catalog no. 33R-4131, is also available for use as a blocking control in assays to test for specificity of this GLT8D2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLT8D2

Target: GLT8D2 (Glycosyltransferase 8 Domain Containing 2 (GLT8D2))

Alternative Name: GLT8D2 (GLT8D2 Products)

Synonyms: si:dkey-22l11.1 antibody, zgc:136873 antibody, 1110021D20Rik antibody, RGD1560432 antibody, glycosyltransferase 8 domain containing 2 antibody, GLT8D2 antibody, glt8d2 antibody, Glt8d2 antibody

Background: GLT8D2 belongs to the glycosyltransferase 8 family. The exact function of it remains unknown.

Molecular Weight: 40 kDa (MW of target protein)