UGT2A3 antibody (N-Term)

Catalog No. ABIN636014

Product Details anti-UGT2A3 Antibody

Target: UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT2A3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGT2 A3 antibody was raised against the N terminal of µgT2 3

Purification: Affinity purified

Immunogen: UGT2 A3 antibody was raised using the N terminal of µgT2 3 corresponding to a region with amino acids NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT2A3 Blocking Peptide, catalog no. 33R-6917, is also available for use as a blocking control in assays to test for specificity of this µgT2A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT2A3

Target: UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))

Alternative Name: UGT2A3 (UGT2A3 Products)

Synonyms: UGT2A1 antibody, zgc:112491 antibody, 2010321J07Rik antibody, RGD1308444 antibody, Ugt2a3 antibody, UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus antibody, UDP glucuronosyltransferase family 2 member A3 antibody, UDP glucuronosyltransferase family 2 member A1 complex locus antibody, UDP glucuronosyltransferase 2 family, polypeptide A3 antibody, UDP-glucuronosyltransferase 2A3 antibody, UDP-glucuronosyltransferase 2A3-like antibody, UGT2A1 antibody, UGT2A3 antibody, LOC100351592 antibody, LOC100359229 antibody, ugt2a3 antibody, LOC100596311 antibody, Ugt2a3 antibody, LOC100135631 antibody

Background: UGT2A3 is a single-pass type I membrane proteinPotential. It belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis