MANEA antibody (Middle Region)

Catalog No. ABIN636012

Product Details anti-MANEA Antibody

Target: MANEA (Mannosidase, Endo-alpha (MANEA))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MANEA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MANEA antibody was raised against the middle region of MANEA

Purification: Affinity purified

Immunogen: MANEA antibody was raised using the middle region of MANEA corresponding to a region with amino acids KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MANEA Blocking Peptide, catalog no. 33R-4723, is also available for use as a blocking control in assays to test for specificity of this MANEA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MANEA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MANEA

Target: MANEA (Mannosidase, Endo-alpha (MANEA))

Alternative Name: MANEA (MANEA Products)

Synonyms: ENDO antibody, hEndo antibody, Enman antibody, 4932703L02Rik antibody, fi29h09 antibody, zgc:92825 antibody, wu:fi29h09 antibody, mannosidase endo-alpha antibody, mannosidase, endo-alpha antibody, MANEA antibody, Manea antibody, manea antibody

Background: N-glycosylation of proteins is initiated in the endoplasmic reticulum (ER) by the transfer of the preassembled oligosaccharide glucose-3-mannose-9-N-acetylglucosamine-2 from dolichyl pyrophosphate to acceptor sites on the target protein by an oligosaccharyltransferase complex.

Molecular Weight: 54 kDa (MW of target protein)