SRD5A3 antibody (N-Term)
-
- Target See all SRD5A3 Antibodies
- SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SRD5A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SRD5 A3 antibody was raised against the N terminal of SRD5 3
- Purification
- Affinity purified
- Immunogen
- SRD5 A3 antibody was raised using the N terminal of SRD5 3 corresponding to a region with amino acids GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN
- Top Product
- Discover our top product SRD5A3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SRD5A3 Blocking Peptide, catalog no. 33R-3408, is also available for use as a blocking control in assays to test for specificity of this SRD5A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRD0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))
- Alternative Name
- SRD5A3 (SRD5A3 Products)
- Background
- SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis
-