SRD5A3 antibody (N-Term)

Catalog No. ABIN636011

Product Details anti-SRD5A3 Antibody

Target: SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRD5A3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SRD5 A3 antibody was raised against the N terminal of SRD5 3

Purification: Affinity purified

Immunogen: SRD5 A3 antibody was raised using the N terminal of SRD5 3 corresponding to a region with amino acids GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SRD5A3 Blocking Peptide, catalog no. 33R-3408, is also available for use as a blocking control in assays to test for specificity of this SRD5A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRD0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRD5A3

Target: SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))

Alternative Name: SRD5A3 (SRD5A3 Products)

Synonyms: CDG1P antibody, CDG1Q antibody, KRIZI antibody, SRD5A2L antibody, SRD5A2L1 antibody, 1110025P14Rik antibody, A430076C09 antibody, AV364670 antibody, AW987574 antibody, D730040M03Rik antibody, H5ar antibody, S5AR 3 antibody, Srd5a2l antibody, RGD1308828 antibody, SRD5alpha3 antibody, steroid 5 alpha-reductase 3 antibody, steroid 5 alpha-reductase 3 S homeolog antibody, SRD5A3 antibody, Srd5a3 antibody, srd5a3.S antibody

Background: SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis