SCUBE2 antibody (C-Term)
-
- Target See all SCUBE2 products
- SCUBE2 (Signal Peptide, CUB Domain, EGF-Like 2 (SCUBE2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SCUBE2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SCUBE2 antibody was raised against the C terminal of SCUBE2
- Purification
- Affinity purified
- Immunogen
- SCUBE2 antibody was raised using the C terminal of SCUBE2 corresponding to a region with amino acids KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SCUBE2 Blocking Peptide, catalog no. 33R-4686, is also available for use as a blocking control in assays to test for specificity of this SCUBE2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCUBE2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCUBE2 (Signal Peptide, CUB Domain, EGF-Like 2 (SCUBE2))
- Alternative Name
- SCUBE2 (SCUBE2 Products)
- Synonyms
- CEGB1 antibody, CEGF1 antibody, CEGP1 antibody, 4932442O19Rik antibody, Cegf1 antibody, Cegp1 antibody, RGD1563998 antibody, Scube2-ps1 antibody, wu:fc27f08 antibody, you antibody, signal peptide, CUB domain and EGF like domain containing 2 antibody, signal peptide, CUB domain, EGF-like 2 antibody, SCUBE2 antibody, Scube2 antibody, scube2 antibody
- Background
- SCUBE2 contains 1 CUB domain and 9 EGF-like domains. The function of the SCUBE2 protein remains unknown.
- Molecular Weight
- 110 kDa (MW of target protein)
-