Emc7 antibody (Middle Region)

Catalog No. ABIN636001

Product Details anti-Emc7 Antibody

Target: Emc7 (ER membrane protein complex subunit 7 (Emc7))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Emc7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C15 ORF24 antibody was raised against the middle region of C15 rf24

Purification: Affinity purified

Immunogen: C15 ORF24 antibody was raised using the middle region of C15 rf24 corresponding to a region with amino acids VDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C15ORF24 Blocking Peptide, catalog no. 33R-9464, is also available for use as a blocking control in assays to test for specificity of this C15ORF24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Emc7

Target: Emc7 (ER membrane protein complex subunit 7 (Emc7))

Alternative Name: C15ORF24 (Emc7 Products)

Synonyms: si:ch211-150c22.3 antibody, c15orf24 antibody, C10H15orf24 antibody, C15orf24 antibody, C11orf3 antibody, ORF1-FL1 antibody, 2900064A13Rik antibody, AI451465 antibody, ORF3 antibody, c11orf3 antibody, ER membrane protein complex subunit 7 antibody, emc7 antibody, EMC7 antibody, Emc7 antibody

Background: The function of C15orf24 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 26 kDa (MW of target protein)