TMEM51 antibody (N-Term)

Catalog No. ABIN635996

Product Details anti-TMEM51 Antibody

Target: TMEM51 (Transmembrane Protein 51 (TMEM51))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM51 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM51 antibody was raised against the N terminal of TMEM51

Purification: Affinity purified

Immunogen: TMEM51 antibody was raised using the N terminal of TMEM51 corresponding to a region with amino acids GFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLVGAGVMLLLLSICLSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM51 Blocking Peptide, catalog no. 33R-3264, is also available for use as a blocking control in assays to test for specificity of this TMEM51 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM51 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM51

Target: TMEM51 (Transmembrane Protein 51 (TMEM51))

Alternative Name: TMEM51 (TMEM51 Products)

Synonyms: C1orf72 antibody, BC003277 antibody, MGC81093 antibody, RGD1565452 antibody, MGC152450 antibody, fd15a06 antibody, wu:fd15a06 antibody, zgc:171659 antibody, transmembrane protein 51 antibody, transmembrane protein 51 S homeolog antibody, transmembrane protein 51b antibody, TMEM51 antibody, Tmem51 antibody, tmem51.S antibody, tmem51 antibody, tmem51b antibody

Background: TMEM51 is a multi-pass membrane protein. The function of the TMEM51 protein remains unknown.

Molecular Weight: 28 kDa (MW of target protein)