FAM20A antibody (N-Term)

Catalog No. ABIN635991

Product Details anti-FAM20A Antibody

Target: FAM20A (Family with Sequence Similarity 20, Member A (FAM20A))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM20A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM20 A antibody was raised against the N terminal of FAM20

Purification: Affinity purified

Immunogen: FAM20 A antibody was raised using the N terminal of FAM20 corresponding to a region with amino acids SKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM20A Blocking Peptide, catalog no. 33R-8558, is also available for use as a blocking control in assays to test for specificity of this FAM20A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM20A

Target: FAM20A (Family with Sequence Similarity 20, Member A (FAM20A))

Alternative Name: FAM20A (FAM20A Products)

Synonyms: AIGFS antibody, FP2747 antibody, AI606893 antibody, FAM20A, golgi associated secretory pathway pseudokinase antibody, family with sequence similarity 20, member A antibody, FAM20A antibody, Fam20a antibody

Background: The exact function of this gene remains unknown.

Molecular Weight: 61 kDa (MW of target protein)