A4GNT antibody (C-Term)
-
- Target See all A4GNT Antibodies
- A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This A4GNT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- A4 GNT antibody was raised against the C terminal of A4 NT
- Purification
- Affinity purified
- Immunogen
- A4 GNT antibody was raised using the C terminal of A4 NT corresponding to a region with amino acids NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV
- Top Product
- Discover our top product A4GNT Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
A4GNT Blocking Peptide, catalog no. 33R-6732, is also available for use as a blocking control in assays to test for specificity of this A4GNT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 NT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))
- Alternative Name
- A4GNT (A4GNT Products)
- Background
- A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Golgi apparatus membrane.
- Molecular Weight
- 39 kDa (MW of target protein)
-