A4GNT antibody (C-Term)

Catalog No. ABIN635982

Product Details anti-A4GNT Antibody

Target: A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This A4GNT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: A4 GNT antibody was raised against the C terminal of A4 NT

Purification: Affinity purified

Immunogen: A4 GNT antibody was raised using the C terminal of A4 NT corresponding to a region with amino acids NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

A4GNT Blocking Peptide, catalog no. 33R-6732, is also available for use as a blocking control in assays to test for specificity of this A4GNT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 NT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for A4GNT

Target: A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))

Alternative Name: A4GNT (A4GNT Products)

Synonyms: A4GNT antibody, a4gnt antibody, MGC116495 antibody, ALPHA4GNT antibody, alpha4GnT antibody, AV080780 antibody, Alpha4gnt antibody, Gm798 antibody, alpha-1,4-N-acetylglucosaminyltransferase antibody, alpha-1,4-N-acetylglucosaminyltransferase L homeolog antibody, A4GNT antibody, a4gnt antibody, a4gnt.L antibody, A4gnt antibody

Background: A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Golgi apparatus membrane.

Molecular Weight: 39 kDa (MW of target protein)