TMX2 antibody (Middle Region)
-
- Target See all TMX2 Antibodies
- TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMX2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TXNDC14 antibody was raised against the middle region of TXNDC14
- Purification
- Affinity purified
- Immunogen
- TXNDC14 antibody was raised using the middle region of TXNDC14 corresponding to a region with amino acids IRMGLLYITLCIVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWI
- Top Product
- Discover our top product TMX2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TXNDC14 Blocking Peptide, catalog no. 33R-4138, is also available for use as a blocking control in assays to test for specificity of this TXNDC14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))
- Alternative Name
- TXNDC14 (TMX2 Products)
- Synonyms
- PDIA12 antibody, PIG26 antibody, TXNDC14 antibody, 2310042M24Rik antibody, AA589631 antibody, Txndc14 antibody, tmx2 antibody, txndc14 antibody, wu:fb73h06 antibody, zgc:86830 antibody, pig26 antibody, cgi-31 antibody, MGC79568 antibody, DKFZp469G2332 antibody, im:7138651 antibody, zgc:172264 antibody, thioredoxin related transmembrane protein 2 antibody, thioredoxin-related transmembrane protein 2 antibody, thioredoxin-related transmembrane protein 2b antibody, thioredoxin domain containing 14 antibody, thioredoxin related transmembrane protein 2 S homeolog antibody, thioredoxin-related transmembrane protein 2a antibody, TMX2 antibody, Tmx2 antibody, tmx2b antibody, tmx2 antibody, CpipJ_CPIJ000873 antibody, tmx2.S antibody, tmx2a antibody
- Background
- The function of TXNDC14 has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 34 kDa (MW of target protein)
-