ICMT antibody (Middle Region)
-
- Target See all ICMT Antibodies
- ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ICMT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ICMT antibody was raised against the middle region of ICMT
- Purification
- Affinity purified
- Immunogen
- ICMT antibody was raised using the middle region of ICMT corresponding to a region with amino acids GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI
- Top Product
- Discover our top product ICMT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ICMT Blocking Peptide, catalog no. 33R-3574, is also available for use as a blocking control in assays to test for specificity of this ICMT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICMT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))
- Alternative Name
- ICMT (ICMT Products)
- Background
- ICMT is the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined.
- Molecular Weight
- 32 kDa (MW of target protein)
-