TMEM115 antibody (N-Term)

Catalog No. ABIN635970

Product Details anti-TMEM115 Antibody

Target: TMEM115 (Transmembrane Protein 115 (TMEM115))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM115 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM115 antibody was raised against the N terminal of TMEM115

Purification: Affinity purified

Immunogen: TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM115 Blocking Peptide, catalog no. 33R-5190, is also available for use as a blocking control in assays to test for specificity of this TMEM115 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM115 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM115

Target: TMEM115 (Transmembrane Protein 115 (TMEM115))

Alternative Name: TMEM115 (TMEM115 Products)

Background: The specific function of TMEM115 is not yet known.

Molecular Weight: 38 kDa (MW of target protein)