ST3GAL2 antibody (C-Term)

Catalog No. ABIN635969

Product Details anti-ST3GAL2 Antibody

Target: ST3GAL2 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 2 (ST3GAL2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST3GAL2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ST3 GAL2 antibody was raised against the C terminal of ST3 AL2

Purification: Affinity purified

Immunogen: ST3 GAL2 antibody was raised using the C terminal of ST3 AL2 corresponding to a region with amino acids ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST3GAL2 Blocking Peptide, catalog no. 33R-1106, is also available for use as a blocking control in assays to test for specificity of this ST3GAL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST3GAL2

Target: ST3GAL2 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 2 (ST3GAL2))

Alternative Name: ST3GAL2 (ST3GAL2 Products)

Synonyms: Gal-NAc6S antibody, SIAT4B antibody, ST3GALII antibody, ST3GalA.2 antibody, AI429591 antibody, AW822065 antibody, ST3GalII antibody, Siat5 antibody, Siat4b antibody, siat5 antibody, si:ch211-223o1.7 antibody, ST3GAL2 antibody, siat4-r1 antibody, st3Gal I.1 antibody, ST3GAL-II antibody, SIAT5 antibody, ST3 beta-galactoside alpha-2,3-sialyltransferase 2 antibody, ST3 beta-galactoside alpha-2,3-sialyltransferase 1 antibody, ST3GAL2 antibody, St3gal2 antibody, st3gal2 antibody, st3gal1 antibody

Background: ST3GAL2 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process