TMED1 antibody (Middle Region)
-
- Target See all TMED1 Antibodies
- TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMED1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMED1 antibody was raised against the middle region of TMED1
- Purification
- Affinity purified
- Immunogen
- TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF
- Top Product
- Discover our top product TMED1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMED1 Blocking Peptide, catalog no. 33R-3095, is also available for use as a blocking control in assays to test for specificity of this TMED1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))
- Alternative Name
- TMED1 (TMED1 Products)
- Synonyms
- Il1rl1l antibody, Ly84l antibody, St2l antibody, IL1RL1LG antibody, Tp24 antibody, tmed1 antibody, zgc:92038 antibody, zgc:158680 antibody, transmembrane p24 trafficking protein 1 antibody, transmembrane p24 trafficking protein 1a antibody, transmembrane p24 trafficking protein 1b antibody, Tmed1 antibody, TMED1 antibody, tmed1a antibody, tmed1b antibody
- Background
- TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.
- Molecular Weight
- 23 kDa (MW of target protein)
-