ERLIN1 antibody (N-Term)

Catalog No. ABIN635966

Product Details anti-ERLIN1 Antibody

Target: ERLIN1 (ER Lipid Raft Associated 1 (ERLIN1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERLIN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ERLIN1 antibody was raised against the N terminal of ERLIN1

Purification: Affinity purified

Immunogen: ERLIN1 antibody was raised using the N terminal of ERLIN1 corresponding to a region with amino acids KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERLIN1 Blocking Peptide, catalog no. 33R-4577, is also available for use as a blocking control in assays to test for specificity of this ERLIN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERLIN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERLIN1

Target: ERLIN1 (ER Lipid Raft Associated 1 (ERLIN1))

Alternative Name: ERLIN1 (ERLIN1 Products)

Synonyms: C10orf69 antibody, Erlin-1 antibody, KE04 antibody, KEO4 antibody, SPFH1 antibody, wu:fa10h05 antibody, wu:fb19h05 antibody, zgc:110547 antibody, 2810439N09Rik antibody, C80197 antibody, Keo4 antibody, Spfh1 antibody, RGD1307058 antibody, erlin-1 antibody, ER lipid raft associated 1 antibody, ERLIN1 antibody, erlin1 antibody, Erlin1 antibody

Background: Erlin-1 belongs to the band 7/mec-2 family. Erlin-1 and erlin-2 are novel members of the prohibitin family of proteins that define lipid-raft-like domains of the ER.

Molecular Weight: 39 kDa (MW of target protein)